PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009597443.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 525aa    MW: 57170 Da    PI: 8.1339
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009597443.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.28.2e-34232288259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     dDgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d++v+ei+Y+g+Hnh+
  XP_009597443.1 232 DDGYNWRKYGQKQVKGSEYPRSYYKCTHSNCPVKKKVERSL-DGQVTEIIYKGQHNHQ 288
                     8****************************************.***************8 PP

2WRKY1079.6e-34411469159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Cts+gC+v+k+ver+a+dpk+v++tYeg+Hnh+
  XP_009597443.1 411 LDDGYRWRKYGQKVVKGNPYPRSYYKCTSQGCNVRKHVERAASDPKAVITTYEGKHNHD 469
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081124.134226290IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.2E-30226290IPR003657WRKY domain
SuperFamilySSF1182902.09E-26229290IPR003657WRKY domain
SMARTSM007741.8E-37231289IPR003657WRKY domain
PfamPF031065.8E-26232288IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-37396471IPR003657WRKY domain
SuperFamilySSF1182906.02E-30403471IPR003657WRKY domain
PROSITE profilePS5081139.192406471IPR003657WRKY domain
SMARTSM007742.9E-40411470IPR003657WRKY domain
PfamPF031062.5E-26412469IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MAENEGSSSS SSTSRAQLLR PTITLPPRNS MESLFSGGSN GISPGPMTLV SSFFSDNDPD  60
SDCRSFSQLL AGAMSSPAGF SGVRPGFPPV PPPSTAAMAQ EYKQSRPTGL VISQPPTTFT  120
VPPGLSPGGL LDGFFSPGQG PFGMSHQQVL AQFTTQAAPA QSQLHIRPDY PSSSTAAAAS  180
LSQFQSLASN AAANQQIPPP ALNPNIVKES SDVSLSDQRS EPASFAVDKP ADDGYNWRKY  240
GQKQVKGSEY PRSYYKCTHS NCPVKKKVER SLDGQVTEII YKGQHNHQPP QSSKRSKESG  300
NPNGNYNLQG SYEPSSEGLA GNFNKPKEGE TSYSLRMKDH ESSQATHDQI SGSSDSEEVG  360
DAQTRVDGRD IDERESKRRA VEVQTSEAAC SHRTVTEPRI IVQTTSEVDL LDDGYRWRKY  420
GQKVVKGNPY PRSYYKCTSQ GCNVRKHVER AASDPKAVIT TYEGKHNHDV PAARNSSHNT  480
TNNSMSQLRP HNPVVDKPAA MRRTDFPNNE QQPIVLLRFK EEQIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-42232472878Probable WRKY transcription factor 4
2lex_A3e-42232472878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7111330.0AB711133.1 Nicotiana benthamiana NbWRKY12 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597443.10.0PREDICTED: probable WRKY transcription factor 4
RefseqXP_016450004.10.0PREDICTED: probable WRKY transcription factor 4
SwissprotQ9ZQ701e-167WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLA0A0P0UVN00.0A0A0P0UVN0_NICBE; Transcription factor
STRINGPGSC0003DMT4000728360.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41072445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-148WRKY DNA-binding protein 3